Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Wine Box
Sub-Categories
Flat Pack Wine Box
2 product(s) found for "Wine Box"
Flat easy to assemble wine box
Wine Box
Flat easy to assemble wine box
Important Overview Handmade Materials: Sustaniably Sourced Poplar Plywood, Acrylic, Rope Handle Easy to assemble flat wine box. Personalised message plaques can be added Airbrushed colour can be added...
£10.00
Units in Stock: 5
£10.00
Details
Add To Cart
Important Overview Handmade Materials: Sustaniably Sourced Poplar Plywood, Acrylic, Rope Handle Easy to assemble flat wine box. Personalised message plaques can be added Airbrushed colour can be added...
Wine box with Bespoke sides
Wine Box
Wine box with Bespoke sides
Important Overview Handmade Materials: Sustaniably Sourced Poplar Plywood, Acrylic, Rope Handle Easy to assemble flat wine box. Personalised message plaques can be added Airbrushed colour can be added...
£12.00
Units in Stock: 5
£12.00
Details
Add To Cart
Important Overview Handmade Materials: Sustaniably Sourced Poplar Plywood, Acrylic, Rope Handle Easy to assemble flat wine box. Personalised message plaques can be added Airbrushed colour can be added...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i