Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Hanging Sign
6 product(s) found for "Hanging Sign"
All You Need is Love and a D..
Bespoke Designs
All You Need is Love and a D..
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 18 centimeters Height: 28 centimeters Item Overview This beautiful sign can make the perfect...
£3.00
Units in Stock: 1
£3.00
Details
Add To Cart
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 18 centimeters Height: 28 centimeters Item Overview This beautiful sign can make the perfect...
All you need is Love Meow
Bespoke Designs
All you need is Love Meow
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 13 centimeters Height: 14 centimeters Item Overview This beautiful sign can make the perfect...
£3.00
Units in Stock: 1
£3.00
Details
Add To Cart
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 13 centimeters Height: 14 centimeters Item Overview This beautiful sign can make the perfect...
Beware Of The Wife
Bespoke Designs
Beware Of The Wife
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 18 centimeters Height: 8.5 centimeters Item Overview This beautiful signs can make the perfect...
£3.00
Units in Stock: 1
£3.00
Details
Add To Cart
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 18 centimeters Height: 8.5 centimeters Item Overview This beautiful signs can make the perfect...
Four Paws
Bespoke Designs
Four Paws
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 11 centimeters Height: 11 centimeters Item Overview This beautiful sign can make the perfect...
£3.00
Units in Stock: 1
£3.00
Details
Add To Cart
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 11 centimeters Height: 11 centimeters Item Overview This beautiful sign can make the perfect...
Happiness Has Four Paws
Bespoke Designs
Happiness Has Four Paws
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 20 centimeters Height: 15 centimeters Item Overview This beautiful sign can make the perfect...
£5.00
Units in Stock: 1
£5.00
Details
Add To Cart
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 20 centimeters Height: 15 centimeters Item Overview This beautiful sign can make the perfect...
Love Me Love My Dog
Bespoke Designs
Love Me Love My Dog
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 13 centimeters Height: 12 centimeters Item Overview This beautiful signs can make the perfect...
£3.00
Units in Stock: 10
£3.00
Details
Add To Cart
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 13 centimeters Height: 12 centimeters Item Overview This beautiful signs can make the perfect...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i