Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Bespoke Designs
Sub-Categories
MagnetsheartAnimalsAlphabet
38 product(s) found for "Bespoke Designs"
A Home without a Dog is Just..
Bespoke Designs
A Home without a Dog is Just..
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 13 centimeters Height: 12 centimeters Item Overview This beautiful signs can make the perfect...
£3.00
Units in Stock: 3
£3.00
Details
Add To Cart
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 13 centimeters Height: 12 centimeters Item Overview This beautiful signs can make the perfect...
All You Need Is Love
Bespoke Designs
All You Need Is Love
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 11 centimeters Height: 11 centimeters Item Overview This beautiful sign can make the perfect...
£3.00
Units in Stock: 3
£3.00
Details
Add To Cart
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 11 centimeters Height: 11 centimeters Item Overview This beautiful sign can make the perfect...
All You Need is Love and a D..
Bespoke Designs
All You Need is Love and a D..
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 18 centimeters Height: 28 centimeters Item Overview This beautiful sign can make the perfect...
£3.00
Units in Stock: 1
£3.00
Details
Add To Cart
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 18 centimeters Height: 28 centimeters Item Overview This beautiful sign can make the perfect...
All you need is Love Meow
Bespoke Designs
All you need is Love Meow
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 13 centimeters Height: 14 centimeters Item Overview This beautiful sign can make the perfect...
£3.00
Units in Stock: 1
£3.00
Details
Add To Cart
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 13 centimeters Height: 14 centimeters Item Overview This beautiful sign can make the perfect...
Best Friend Cat
Bespoke Designs
Best Friend Cat
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 15 centimeters Height: 17 centimeters Item Overview This beautiful sign can make the perfect...
£4.00
Units in Stock: 1
£4.00
Details
Add To Cart
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 15 centimeters Height: 17 centimeters Item Overview This beautiful sign can make the perfect...
Best Friend Dog
Bespoke Designs
Best Friend Dog
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 15 centimeters Height: 17 centimeters Item Overview This beautiful sign can make the perfect...
£4.00
Units in Stock: 1
£4.00
Details
Add To Cart
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 15 centimeters Height: 17 centimeters Item Overview This beautiful sign can make the perfect...
Beware of the Dog
Bespoke Designs
Beware of the Dog
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 13 centimeters Height: 12 centimeters Item Overview This beautiful signs can make the perfect...
£3.00
Units in Stock: 2
£3.00
Details
Add To Cart
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 13 centimeters Height: 12 centimeters Item Overview This beautiful signs can make the perfect...
Beware of the Dog
Bespoke Designs
Beware of the Dog
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 13 centimeters Height: 14 centimeters Item Overview This beautiful sign can make the perfect...
£3.00
Units in Stock: 1
£3.00
Details
Add To Cart
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 13 centimeters Height: 14 centimeters Item Overview This beautiful sign can make the perfect...
Beware Of The Wife
Bespoke Designs
Beware Of The Wife
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 18 centimeters Height: 8.5 centimeters Item Overview This beautiful signs can make the perfect...
£3.00
Units in Stock: 1
£3.00
Details
Add To Cart
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 18 centimeters Height: 8.5 centimeters Item Overview This beautiful signs can make the perfect...
Big Softy
Bespoke Designs
Big Softy
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 11 centimeters Height: 11 centimeters Item Overview This beautiful sign can make the perfect...
£3.00
Units in Stock: 1
£3.00
Details
Add To Cart
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 11 centimeters Height: 11 centimeters Item Overview This beautiful sign can make the perfect...
Cat House
Bespoke Designs
Cat House
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 16.5 centimeters Height: 14 centimeters Item Overview This beautiful sign can make the perfect...
£4.00
Units in Stock: 1
£4.00
Details
Add To Cart
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 16.5 centimeters Height: 14 centimeters Item Overview This beautiful sign can make the perfect...
Dog House
Bespoke Designs
Dog House
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 16.5 centimeters Height: 14 centimeters Item Overview This beautiful sign can make the perfect...
£4.00
Units in Stock: 1
£4.00
Details
Add To Cart
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 16.5 centimeters Height: 14 centimeters Item Overview This beautiful sign can make the perfect...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i