Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Wall Hanging
41 product(s) found for "Wall Hanging"
Life Is Short Hug Your Dog
Bespoke Designs
Life Is Short Hug Your Dog
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 11 centimeters Height: 11 centimeters Item Overview This beautiful sign can make the perfect...
£3.00
Units in Stock: 1
£3.00
Details
Add To Cart
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 11 centimeters Height: 11 centimeters Item Overview This beautiful sign can make the perfect...
Life's Ruff
Bespoke Designs
Life's Ruff
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Plaques available in 3 sizes. Overview This beautiful sign can make the perfect present for anyone...
£4.00
Units in Stock: 6
£4.00
Details
Add To Cart
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Plaques available in 3 sizes. Overview This beautiful sign can make the perfect present for anyone...
Mans Best Friend
Bespoke Designs
Mans Best Friend
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 15.5 centimeters Height: 20 centimeters Item Overview This beautiful sign can make the perfect...
£4.00
Units in Stock: 1
£4.00
Details
Add To Cart
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 15.5 centimeters Height: 20 centimeters Item Overview This beautiful sign can make the perfect...
Mans Best Friend Circle
Bespoke Designs
Mans Best Friend Circle
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 11 centimeters Height: 11 centimeters Item Overview This beautiful sign can make the perfect...
£3.00
Units in Stock: 1
£3.00
Details
Add To Cart
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 11 centimeters Height: 11 centimeters Item Overview This beautiful sign can make the perfect...
Mum Heart Wall Hanging
Wall Hanging
Mum Heart Wall Hanging
MUM wall hanging or door plaque made from 4mm American Walnut Veneered MDF. Approx 23cm x 20cm
£10.00
Units in Stock: 10
£10.00
Details
Add To Cart
MUM wall hanging or door plaque made from 4mm American Walnut Veneered MDF. Approx 23cm x 20cm
My Best Friend
Bespoke Designs
My Best Friend
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 11 centimeters Height: 11 centimeters Item Overview This beautiful sign can make the perfect...
£3.00
Units in Stock: 1
£3.00
Details
Add To Cart
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 11 centimeters Height: 11 centimeters Item Overview This beautiful sign can make the perfect...
Pawprints a & b
Bespoke Designs
Pawprints a & b
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 18 centimeters Height: 20 centimeters Item Overview This beautiful signs can make the perfect...
£5.00
Units in Stock: 1
£5.00
Details
Add To Cart
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 18 centimeters Height: 20 centimeters Item Overview This beautiful signs can make the perfect...
People I Meet
Bespoke Designs
People I Meet
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 13 centimeters Height: 14 centimeters Item Overview This beautiful sign can make the perfect...
£3.00
Units in Stock: 1
£3.00
Details
Add To Cart
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 13 centimeters Height: 14 centimeters Item Overview This beautiful sign can make the perfect...
Rescued is my Favorite Breed
Bespoke Designs
Rescued is my Favorite Breed
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 13 centimeters Height: 12 centimeters Item Overview This beautiful sign can make the perfect...
£3.00
Units in Stock: 1
£3.00
Details
Add To Cart
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 13 centimeters Height: 12 centimeters Item Overview This beautiful sign can make the perfect...
Slobbery Kisses
Wall Hanging
Slobbery Kisses
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 18.5 centimeters Height: 7.5 centimeters Item Overview This beautiful sign can make the perfect...
£3.00
Units in Stock: 1
£3.00
Details
Add To Cart
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 18.5 centimeters Height: 7.5 centimeters Item Overview This beautiful sign can make the perfect...
Square Circular wall hanging
Wall Hanging
Square Circular wall hanging
MDF square wall hanging with chain effect detail. Can be painted Aprrox. 35 x 35 cm
£8.00
Units in Stock: 5
£8.00
Details
Add To Cart
MDF square wall hanging with chain effect detail. Can be painted Aprrox. 35 x 35 cm
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i