Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Wall Hanging
41 product(s) found for "Wall Hanging"
Square Floral Detailed wall ..
Wall Hanging
Square Floral Detailed wall ..
MDF square wall hanging with floral design. Can be painted Approx 35 x 35 cm
£8.00
Units in Stock: 5
£8.00
Details
Add To Cart
MDF square wall hanging with floral design. Can be painted Approx 35 x 35 cm
The More People I Meet
Bespoke Designs
The More People I Meet
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 13 centimeters Height: 13.5 centimeters Item Overview This beautiful sign can make the perfect...
£3.00
Units in Stock: 1
£3.00
Details
Add To Cart
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 13 centimeters Height: 13.5 centimeters Item Overview This beautiful sign can make the perfect...
Welcome a & b
Bespoke Designs
Welcome a & b
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 31 centimeters Height: 20 centimeters Item Overview This beautiful sign can make the perfect...
£6.00
Units in Stock: 1
£6.00
Details
Add To Cart
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 31 centimeters Height: 20 centimeters Item Overview This beautiful sign can make the perfect...
Wipe Your Paws
Bespoke Designs
Wipe Your Paws
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 19.5 centimeters Height: 11 centimeters Item Overview This beautiful signs can make the perfect...
£3.00
Units in Stock: 1
£3.00
Details
Add To Cart
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 19.5 centimeters Height: 11 centimeters Item Overview This beautiful signs can make the perfect...
With You By My Side
Bespoke Designs
With You By My Side
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 20 centimeters Height: 28 centimeters Item Overview This beautiful sign can make the perfect...
£4.00
Units in Stock: 1
£4.00
Details
Add To Cart
Item Overview Handmade Materials: Sustainably Sourced Poplar Plywood, Walnut Veneer, Cotton Twisted Cord Width: 20 centimeters Height: 28 centimeters Item Overview This beautiful sign can make the perfect...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i